SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4GQG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4GQG1
Domain Number 1 Region: 20-191
Classification Level Classification E-value
Superfamily Proteasome activator 4.97e-37
Family Proteasome activator 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4GQG1
Sequence length 202
Comment (tr|B4GQG1|B4GQG1_DROPE) GL14290 {ECO:0000313|EMBL:EDW39833.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL14290 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSSMSENAITYPKALVAKLGTQLIAKDLPKEIVELNELLDSPMFKEVEQEQGTPVLPSAG
KAVCEMMEVVKPILRTLIANANLFNLWVSSMIPEGVSGDSLGVSIQKHLQEEIVKVQSEA
DAYFETFPKYFETRAKAARIASEYPHVEECGQLVVEMDQINILFLQNIVREVRNFYSLLH
DFGTKNWDKLQSGQSSNTNGYH
Download sequence
Identical sequences B4GQG1
XP_002020840.1.64850 FBpp0178397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]