SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4H4X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4H4X2
Domain Number 1 Region: 104-141,202-223
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000209
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  B4H4X2
Domain Number - Region: 155-199
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0418
Family Pseudo ankyrin repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4H4X2
Sequence length 227
Comment (tr|B4H4X2|B4H4X2_DROPE) GL10149 {ECO:0000313|EMBL:EDW32808.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL10149 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSQTQSPTPSTPPASRRAHRPPRINIHNLNSGSAMGMSVGSMPPTAQPPYTSQSNYTGNG
PYWPPVANPFGSGNFMTKGYEGFLDLTKSGMSFGEKFTYGLYNKFSRWSRSWFTHMFLIF
VLALYSVGGALIFQAVEVRQGTLEKLELQGLQKQFFEEMRDMTRNTQLSTLSKTDFDSQV
LRIMNNHPSVVESLLRNGMAEKTDPWSFWNAMVYSCTIYTTIGTRMS
Download sequence
Identical sequences B4H4X2
FBpp0174256 XP_002025901.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]