SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4IFJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4IFJ1
Domain Number 1 Region: 130-373
Classification Level Classification E-value
Superfamily vWA-like 6.52e-69
Family Integrin A (or I) domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 32-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000126
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 590-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number 4 Region: 527-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Integrin beta EGF-like domains 0.022
Further Details:      
 
Domain Number 5 Region: 386-462
Classification Level Classification E-value
Superfamily Integrin domains 0.0000507
Family Integrin domains 0.011
Further Details:      
 
Weak hits

Sequence:  B4IFJ1
Domain Number - Region: 473-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 619-676
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.017
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4IFJ1
Sequence length 800
Comment (tr|B4IFJ1|B4IFJ1_DROSE) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=7238 OS=Drosophila sechellia (Fruit fly). GN=Dsec_GM23386 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTSLRGRAFLWIYLLFLMAEISYSDADSIDDQCRHADSCERCLSAHLECAWCTDKNYQVG
YRCLSRRQLLNYNCSETDIYENQPVLDVLQDKPLKDYETRDQAVQVTPQRAYLKLVKGNT
QRIKLSYRTARNNPLDLYVLMDLTWTMRDDKETLEELGAQLSQTLKNLTGNYRLGFGSFA
DKPTLPMILPQHRENPCAAERATCEPTYGYRHQLSLTDDIPAFTSTVANSKITGNLDNLE
GGLDALMQVIVCTKEISWKEQARKVVILVTDGFMHLAGDGLLAGIIQRNDKQCHLNQAGE
YTGSLDYDYPSLEEIYRELLRRKINVIFAVTEEVVSSYWELSGLMKEISYVDILSADSSN
ILELIKKSYESLIKRTQFADNSPDFIDMAYYTDCGGQFPSLQKRNYCNNVTLGKQIDFYV
DVTLKKYPDNQAYTHKIRVEETSLSEFMDLDVELQRPCPCQETPHPENEKGRFLCDYKGY
LYCGMCECDEGWTGTYCTCPTGATNVTSNEALLQKCRQPFSDKSTSELVCSNHGDCDCGI
CLCDPGYTGPFCECRECLDCDEKLANCSCGQCVCKYGWSGSKCNCSPLHTDACVGPTGEI
CSERGTCQCEKCQCEEPYLGKFCEIDPEKDNKLCLFYEPCVTCLIEQKQGMGVCENLTEI
CSSLDRQETYPYNFVHELDPEQDQCLVRLVNKHGIQCDSFFAYQVVDHSNFLTIQAVDCE
PSDYVALVGYISVFTLLIGLLTIFLFLWYIRAKDAREYAKFEEDQKNSVRQENPIYRDPV
GRYEVPKALSVKHDENPFAS
Download sequence
Identical sequences B4IFJ1
FBpp0204863 XP_002042501.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]