SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4J1X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4J1X0
Domain Number 1 Region: 5-168,200-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.4e-76
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 205-305,333-455,492-550
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 4.32e-16
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  B4J1X0
Domain Number - Region: 626-702
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.068
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4J1X0
Sequence length 1238
Comment (tr|B4J1X0|B4J1X0_DROGR) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH15519 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MLTNFESKSARVKGLSFHPKRPWILTSLHSGVIQLWDYRMHTLLEKFDEHDGPVRSVAFH
QQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVAFHHEYPWILSASDDQTIRIW
NWQSRNCICVLTGHNHYVMCAQFHPTEDQIVSASLDQTVRVWDISGLRKKNVAPGPGGLD
EHLKGHPGATDLFGQADAVVKHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEY
KAWEVDTCRGHYNNVSCVLFHPRQDLIISNGEDRSIRVWDMTKRQCLFTFRRDNERFWIM
AAHPTLNLFAAGHDAGMVVFKLERERPAYAVHGNMLYYVKDRFLRKLDFTTTKDTVVMQL
RPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPKDSESERQNESDSKRSSGITA
IWVARNRFAVLDRNQQLVVKNFKNEVTKKIPTFCEEIFYAGTGMLLIRDPEYVTLYEVQR
LVSVGSIKLAKCRYVVWSPDMSLVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESG
VFIYTTSNHIKYAITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDSTEYKF
KLALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGLALECGNIE
IALQAAKALDDKDCWDRLGQAALLQGNHQVVEMCYQRTKNFDKLSFLYLITGNLEKLKKM
NKIAEIRKDISAQYQGALLLGDVRERVSILKNCGQLSLAYLTAATHGLGDLTESLGAHIT
GEGSTLPEVNPNAQLLQPPVPIQQLETNWPLLSVSKGFFEGAMVTRAGNSATARQALNIN
ADAALLDEHNGGGDGWGADADLGLGEDDDGDEEMHDALSNDEGHDESGGGGGGWDVGDDD
LVVPLELASKIKASALDSNYYAAPNKGQSPAQHWANNSQLVLDHVKAGAFNSAFRLLNDQ
LGVVNFKPFKILFLQSYACSRTSYTANPNLQSLSGYPLRNFGETNPKQQRPALGIKLNEL
VSRLQAGYQMTTSGKFTEAIEKFHSILISIPLLVVETKLDTAEAQQLLKICAEYIVGLKM
ETVRKGMPKSTLEEQKRLCEMAAYFTHCKLQPVHQILTLRTALNMFFKLKNYKTGASFAR
RLLELAPRPEVAQQVRKILQACEVNPVDEHRLEYEEFNPFNICAISWKPLYRGKPEVTCP
FCSSAYDPQYKGQICTVCEVSQIGKDCIGLRISNLQFR
Download sequence
Identical sequences B4J1X0
7222.FBpp0149425 FBpp0149425 XP_001983547.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]