SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4J5K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4J5K7
Domain Number 1 Region: 50-101
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000837
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4J5K7
Sequence length 169
Comment (tr|B4J5K7|B4J5K7_DROGR) GH21072 {ECO:0000313|EMBL:EDW00770.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH21072 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MDQCLKRRRRGKKKLKRGLDKLLQDLKPTFKALDSCTHWAYDQQLYILLSLLTFIKDSRC
VIKRCTKPDRQEFRRSALATAVGLLIMGFLGFVIKLMHIPITNRGVKKGNHSNTQTKNKV
SIQLAADNKRLCILAPGQAELLAIAKIAGHNSHANCMGNKAKLQAAIVD
Download sequence
Identical sequences B4J5K7
XP_001985903.1.65300 FBpp0154978 7222.FBpp0154978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]