SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4J8P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4J8P5
Domain Number 1 Region: 7-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-108
Family Capz alpha-1 subunit 0.0000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4J8P5
Sequence length 286
Comment (tr|B4J8P5|B4J8P5_DROGR) GH20526 {ECO:0000313|EMBL:EDW01312.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH20526 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MEPTQITDTEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDGLLKDGASHAFSQYNKDQL
TPVRVEGSEHNAIISEYNDLGNGRFYDPRTKQSFKYDHLRKEASDYQDLEADANSETWRA
ALDLAALAYTANHYRHGVSSVFGNSQGNQVTLTICIEDHQFQPKNYWNGRWRSQWHVTFQ
PGSGTAELKGVLKVQVHYYEDGNVQLVSSKDCRESLVVSNEQQLANEVIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences B4J8P5
XP_001986445.1.65300 FBpp0154432 7222.FBpp0154432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]