SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4QS18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4QS18
Domain Number 1 Region: 91-186
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 4.19e-27
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4QS18
Sequence length 199
Comment (tr|B4QS18|B4QS18_DROSI) GD19359 {ECO:0000313|EMBL:EDX12214.1} KW=Complete proteome; Reference proteome OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsim_GD19359 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRVNQVAWASALCSATDGVGGASFGGRERTFRSAGIFYFACTTAAGRFYFSLCAARPELG
AGAGGRGVRFAVRRACQCHFSRFACFICHEMVLLDNSNFILRLEKIANAAKKDSSFTLTF
KRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQKISTVVRQEDVPAMMGMYSQFMKSK
MDGLKRVKKVKSKAKATKG
Download sequence
Identical sequences B4QS18
FBpp0217761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]