SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4R8F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4R8F6
Domain Number - Region: 52-174
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0889
Family MW0975(SA0943)-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4R8F6
Sequence length 189
Comment (tr|B4R8F6|B4R8F6_PHEZH) Hemerythrin HHE cation binding region {ECO:0000313|EMBL:ACG77583.1} KW=Complete proteome; Reference proteome OX=450851 OS=Phenylobacterium zucineum (strain HLK1). GN=PHZ_c1169 OC=Caulobacteraceae; Phenylobacterium.
Sequence
MAAASQSTAKKTKSAAAKSKSASAGKSTAKKTAAPKSDPATRLLMQDHRAVEKLFAQYEK
AKEDDAKKQAIYEQIHMELAVHMQIEEEIFYPASRPHVDEQDTVNEAVVEHASARDLMAQ
LKKMKPSDEMYDAKVTVLKEMIEHHVEEEEKEYFPECRKSDMDLKAVGEQLKARKEELMA
EMGGSAARH
Download sequence
Identical sequences B4R8F6
gi|197104635|ref|YP_002130012.1| WP_012521729.1.63133 450851.PHZ_c1169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]