SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4WIM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4WIM7
Domain Number - Region: 7-31
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family variant PHD-like domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4WIM7
Sequence length 39
Comment (tr|B4WIM7|B4WIM7_SYNS7) Uncharacterized protein {ECO:0000313|EMBL:EDX83739.1} KW=Complete proteome; Reference proteome OX=91464 OS=Synechococcus sp. (strain ATCC 29403 / PCC 7335). GN=S7335_1436 OC=Synechococcus.
Sequence
MSSTHLYNRCLACIFAVTMGCLKMMGYLNKSTLIIIQLE
Download sequence
Identical sequences B4WIM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]