SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5IHS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5IHS9
Domain Number 1 Region: 3-79,202-252
Classification Level Classification E-value
Superfamily TPR-like 0.00000000703
Family Tetratricopeptide repeat (TPR) 0.089
Further Details:      
 
Weak hits

Sequence:  B5IHS9
Domain Number - Region: 139-192
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00523
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5IHS9
Sequence length 277
Comment (tr|B5IHS9|B5IHS9_ACIB4) Uncharacterized protein {ECO:0000313|EMBL:EDY34174.1} KW=Complete proteome OX=439481 OS=Aciduliprofundum boonei (strain DSM 19572 / T469). GN=ABOONEI_2734 OC=Archaea; Euryarchaeota; DHVE2 group; Aciduliprofundum.
Sequence
KYAELLKKKGNYNELLKVYNRLYSLTKDEKYLEEGLDIDPGNKDLLITKVRFLMDNNELV
EANRIIEQLKEDYPDDPTVQMLYEEISGGEKEEVKPIAVDELFGDLGIDEAIGDMSTEGN
EAEEVKEETKEEEINKVDAFLEAFKDGNLDKAKEILKGLNPNEFMDLANREISFELAKFM
VDNLEIEKGNIILEEMLSHQAYDYAEKILNEILKRNFKDAKALFYKGKLMAAKGNDMGAR
NFLMMSVKFDSEIKKYIRGDKILKKYENEEWFKKLLS
Download sequence
Identical sequences B5IHS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]