SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5U9W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5U9W7
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 2.09e-39
Family Chemosensory protein Csp2 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5U9W7
Sequence length 116
Comment (tr|B5U9W7|B5U9W7_PAPXU) Chemosensory protein 4b {ECO:0000313|EMBL:BAG71915.1} OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=PxutCSP4b OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MAIATAMPSPSETYTDRFDNIDLDEIIGNRRLLVPYIHCVLDKGKCTPDGKELKSHIAEA
IENDCAKCTEVQRKGTRKVLGHLINNEQEFWDELTARYDPEHKYSVKYENELRTSK
Download sequence
Identical sequences B5U9W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]