SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6B4M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6B4M7
Domain Number - Region: 130-172
Classification Level Classification E-value
Superfamily IpaD-like 0.068
Family IpaD-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6B4M7
Sequence length 178
Comment (tr|B6B4M7|B6B4M7_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:EDZ47839.1} KW=Complete proteome OX=439496 OS=Rhodobacterales bacterium Y4I. GN=RBY4I_3059 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales.
Sequence
MFENDFPLLSTASLSALILHTARSGPVTLDRCEQALDALFRQAGETPGLPPEELRGRLAA
RLSELEIAGILVPGEPRPGEPPNWRMTSRGHQALMRHPEGLDQTDLARYPEFAAHLRATA
HKPCGMDPRTQSYDEGYRACMDGQPFTGNPYAFDTADHQAWESGWTEAQEEQQTGQPG
Download sequence
Identical sequences B6B4M7
WP_008556893.1.48685 WP_008556893.1.5071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]