SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6BM17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6BM17
Domain Number - Region: 46-157
Classification Level Classification E-value
Superfamily IpaD-like 0.000241
Family IpaD-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6BM17
Sequence length 163
Comment (tr|B6BM17|B6BM17_SULGG) Flagellar basal-body rod protein FlgC {ECO:0000256|RuleBase:RU362062} KW=Complete proteome; Reference proteome OX=929558 OS=Sulfurimonas gotlandica (strain DSM 19862 / JCM 16533 / GD1). GN=SMGD1_0881 OC=Helicobacteraceae; Sulfurimonas.
Sequence
MSFLSSFDISGYGLSAQRVRVNTISQNIANAQTTRTEEGGPYRRKEVVFKAIDFNEQFNK
AIGKMTDSAKFEDPLNEGDFGKKVNPAIMSVIVDKISRDDSEPKMKFDPSHPDADANGYV
AYPNINPVIEMADLVEATRSYQANVAAFESSKNMANSAISLLQ
Download sequence
Identical sequences B6BM17
WP_008338793.1.20270 WP_008338793.1.9123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]