SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6D7H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6D7H8
Domain Number - Region: 53-129
Classification Level Classification E-value
Superfamily STAT 0.0228
Family STAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6D7H8
Sequence length 198
Comment (tr|B6D7H8|B6D7H8_9CAUD) Gp5 {ECO:0000313|EMBL:ACI00365.1} KW=Complete proteome; Reference proteome OX=560178 OS=Listeria phage P40. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MMIMPFYEKLIADAFANVEEGSQVTSEGLIKLLNEEFPKHVVPKQTLLDEQAKVKEYKAS
IADLNTKLQATEGNEDIIKQLQADVEAFNQKEAQAQKDLVLNTAIEAVGGKDKDYIRYLL
GDVDLNDQTALTNRLKDLKDSKPSHFEADEPVTEPVVEPEPTPATNLGGYKVLDNGQKNT
QVASQEEATINAIKNAFK
Download sequence
Identical sequences B6D7H8
YP_002261421.1.72344 B6D7H8_9CAUD gi|207270779|ref|YP_002261421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]