SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6DCU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6DCU5
Domain Number - Region: 25-90
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0785
Family Serum albumin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6DCU5
Sequence length 106
Comment (sp|B6DCU5|TXZ06_LYCSI) Toxin-like structure LSTX-D6 OX=434756 OS=Lycosa singoriensis (Wolf spider) (Aranea singoriensis). GN= OC=Araneae; Araneomorphae; Entelegynae; Lycosoidea; Lycosidae; Lycosa.
Sequence
MMKVLVVAALLVTLISYSSSEGIDDLEADELLSLMANEQTRAKACTPRYYDCSHDRHSCC
RSSMFKDVCTCFYPEGGDNKEVCTCQQPKHLKYMEKATDKIKNLFG
Download sequence
Identical sequences B6DCU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]