SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6JYC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6JYC7
Domain Number 1 Region: 2156-2281
Classification Level Classification E-value
Superfamily CheY-like 5.12e-27
Family CheY-related 0.014
Further Details:      
 
Domain Number 2 Region: 40-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.8e-21
Family Protein kinases, catalytic subunit 0.0029
Further Details:      
 
Domain Number 3 Region: 1784-1862
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.82e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 
Domain Number 4 Region: 1478-1646
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000107
Family GAF domain 0.01
Further Details:      
 
Domain Number 5 Region: 1829-1945
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000552
Family Histidine kinase 0.019
Further Details:      
 
Domain Number 6 Region: 397-467,542-699
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000055
Family G proteins 0.083
Further Details:      
 
Domain Number 7 Region: 1715-1786
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000523
Family Flavin-binding PAS domain 0.037
Further Details:      
 
Domain Number 8 Region: 1316-1391
Classification Level Classification E-value
Superfamily TPR-like 0.0000813
Family Tetratricopeptide repeat (TPR) 0.08
Further Details:      
 
Weak hits

Sequence:  B6JYC7
Domain Number - Region: 713-761
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0248
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6JYC7
Sequence length 2287
Comment (tr|B6JYC7|B6JYC7_SCHJY) HisK/Mak3 protein kinase Mak3 {ECO:0000313|EMBL:EEB06545.2} KW=Complete proteome; Reference proteome OX=402676 OS=yeast). GN=SJAG_01587 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MRYRRSLEDAVALAFSLLNSYKLEKRPFRHFQSFLSEFLLYKGVELASNRPIIIKFTFQI
QYLEHEYCCFMDLYRTSGGGNIVLLPIEFCVLSTLELAVAVYEDYGYRFVSMDEYSYFQK
DIALFFEFAIKAAKCLNFMHFHGFVHGELNIWSFCTSPDRRDVRVSTIGQGKNSFQDCLY
MFSWSSSGHSADTNSWLPFISPEQTGRTFDTVDYRTDIYSFGIVLFVLLTGTFPYTGNSV
KLIRAVITEPLPYDDLEKYNVPPLLIKILAKMTQKRPDDRYLSFAGLIYDLQKCRDSFEN
NDPDLSDFQLATHDSTYIFYLPSVTFGREAVLEQAISVMHLNYAAQSAKVQNEAMSDGSF
SADGVSLQEVSSLKEQLSSNPSWNVLLEDPDDFSSVSLFIIGETGIGKSNLVRQLYSRKQ
ALMAISEFTASQYAPYSAILVAVSSIIRQLLTEDEKCVSFFCKCIKERLFSHFDALCIFF
RLVPELKGVFWEELDFLKKDDAFSGFSNLDFIPSTDMSISDPFSSDSNPHDADEGPFSNV
WASVHNSLRSGTSRARFLHVMTEFFRIFSKIRPVALVLENLQFADESSLEFLKRIIDLKV
PVCLIMTLHSDYIYILKNLEKIQSANVLELQLNPLSYQVVAEFLKVVVHKNLDYIAPLVS
YVYHKSMGVPIKIRNITTECYERGILKFSWMVNEWCIDFELLQQINKETYEEDNLQLFLR
KFNRLDDMQKILLSWAAMLGDYFFFNLVRQLAHDSNIPEYRADIDKQSIFPLLRDGLIYE
TEKDDMYRFSHVSNIESVVSFIPKELRKLMFASMSRHCLNDSQYMDNLDVSSYIVRAIDL
LKDDPNRLCYSEILSHEAQKSQLNWESTRAVYLSKKCLQFLTFNDLNAFDKNSRGRALSV
FAQVSELLWFFEDFEETDLLFGQLENLPFSYDQKIPIYMFKCRMLFEQRKPVESYNYCFE
NIKRFDVPLTFLTDFDVDTEFKWMVSRFLSTQAIEQIQPEDLITDSSIMNVSAFLFEAIT
ASLWLPREEQVICTRCVSDVFFEYGPTQYTGYCMIVIAIFTAKTAGSWEDMLQLANIGRT
FNKKYGTRRSKARGEHLFKAFLGNVFLPRGAEDYSSKEVMNLCIASGERVFLSYSYMEML
WVQFLYSSSRSEFLTYCDDYLKEISTWDADAKHASFIAPIIRLVLCTSGYNTLKESQEAF
DNLPLNTHLTTMNLPYGPNFRLYGIWWYSFYMLNLVLQENWLGTLELGNWYIKQHSVLIY
HSPLLFTSMMLAVGAHGILSVSGESAKEKASRAFSSLNFLLKMKEENLNNRCLLYATVIF
IKAYYFKTLDRKVDAAVYFEKILTFSEQNEVPLFAAFAHEQLCDIYSKSGRWVSCSHYIQ
AALNIFSELSFFPKCEILKNRYQNILKITNLRPSLDKATQSSESSHFSQSFLRTDIDSPE
EPESLWYSPPIPEEGDSNEPAWQLENMLTTLDIMDLTSVLKSSQVIASELNWESLLRKIT
AIMMENSCCDAASIIVIDDFRFELVAHRTADHCEVFDPAFPVTETQNYLPSRLLKYAVHS
RQSLFTNNVEADYNFGVEAWTKAYPMGRSLVITPVYQKKKPVALLCLQNHPNAFQTRHLS
VMSILASQVSFAIVNVSLFKKFDKATAMNMEIIASQKQALELVQASKANYKNFINSMPCL
LAKGVVQENIIVKPLGLFWYEYCPNFDDTRPDFMKVLIHPEDLPKVKKLILQIHKDCQSP
PIIEVRFLTKSKKYRWNLMSANPLHDCEVNNEILLAAVDIHDQKQARASAFKVMQLRANF
LANISHELRTPFSGFYGMLSLLAETNLDDEQRDIVATAKDSCEMLLQIINDLLNFTKLEA
GKSLLSIFIIAVMAKKIFFAIFIDPQLPSFVAGDSTKIAQVLKTIIENSVSATVEGYVHV
YCDLTKTLHHKNQEDTAVVRFTISDTRPLEKAYERERLIEGLLNPSDESPKVNDSTTLGM
SICLRLCKIMSKNLNVSVNEEKEFFSFSFDVSLKLLNSQRLAILSRKTSDAQTALKKFFK
NMTTIRGRFFDSPTFFDRILLKDKLHELSSRNLEVFEKSLLSLKSEEHQKTDEFLKDNPA
GHSTFFALQLPVTEECFCTALLNFLSKKPYETIQNIIDTHLVTSTSKPFDFDKLKDKVIL
VADDNVISQMTLGKQASRLGMKAEAALDGEIAVRMILEHPPGYYSLAFLDHNMPKMSGLE
VARRIRKYEKQKRDAGHLPIIALTADLKDSVGDACFQVGMDDYIIKPLKNETLLEILKKY
VIEARSN
Download sequence
Identical sequences B6JYC7
XP_002172838.2.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]