SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6QTQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6QTQ9
Domain Number 1 Region: 26-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000204
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  B6QTQ9
Domain Number - Region: 71-120
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.0114
Family Taf5 N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6QTQ9
Sequence length 328
Comment (tr|B6QTQ9|B6QTQ9_TALMQ) C2H2 finger domain protein (Kin17), putative {ECO:0000313|EMBL:EEA19801.1} KW=Complete proteome; Reference proteome OX=441960 OS=(Penicillium marneffei). GN=PMAA_005710 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MPRAEAGSTKAISNKIKSKGLTRLRWYCQPCEKACRDENGFKCHVQSESHVRQMLLIGEN
SKAAIDKYSAEFQREFIELLRTTHGEKKVHVNHFYQQVISNKSHIHMNATKWTSLTQFAA
YLGREGIARVEETEKGLFISWIDNRPETLKRREAVMKKERQDKGDEEREQKLIQQQVERA
RKAELAKAASAADKSEGGSGEESDDKGILERKEGEKVKLSFGAKPSPQPQSDEKPDEKPE
EAAPAKTSISFSASSTAKPKNVFATKPTGVKPSNAFASVKKSTFVPQQQKVSQQEMIMKR
EMEAMEQKKRKFVAGTNVFDAGKKQRVS
Download sequence
Identical sequences B6QTQ9
XP_002152738.1.75516 Pmar_ATCC_18224:PMAA_005710.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]