SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6TTS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6TTS3
Domain Number - Region: 107-138
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 0.0602
Family RNA polymerase subunit RPB10 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6TTS3
Sequence length 146
Comment (tr|B6TTS3|B6TTS3_MAIZE) Protein yippee-like {ECO:0000256|RuleBase:RU110713} OX=4577 OS=Zea mays (Maize). GN= OC=Zea.
Sequence
MAAATTPEEDAASAAAVDATTETTNHFTVNTDAAGADAGPLKLDDVDGNVYSCKRCGTLL
AVADDIVSKSFHCKNGKAYLFDNVVNVTVGEKEDRMTITGMYSVSDIFCVGCGEIVGWKY
EAAHERSQKYKEGKFVLERYLLLGPE
Download sequence
Identical sequences B6TTS3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]