SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6V0C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6V0C1
Domain Number 1 Region: 37-255
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.12e-118
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000345
Further Details:      
 
Domain Number 2 Region: 1-36
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0000000000000981
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6V0C1
Sequence length 255
Comment (tr|B6V0C1|B6V0C1_9ARCH) Methyl coenzyme M reductase subunit alpha {ECO:0000313|EMBL:ACI48648.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
SFIAAYRMCAGEAAVADLSYAAKHAGVIQMASHLPARRARGPNEPGGLGFGIFSDIIQAN
RKYPNDPAKASLEVVGAGVMLYDQIWLGAYMSGGVGFTQYATAAYTDNILDEYTYYGMDY
IKDKYKVDWRNPSPEDRVKPTYDVVNDMATEVTLNAMEQYEQFPTLMEDHFGGSQRAGVI
AAASGLTCSIGTGNSNAGLNGWYLSMLLHKDGWSRLGFFGYDLQDQCGSANSLSIRGDEG
AIGELRGPNYPNYAM
Download sequence
Identical sequences B6V0C1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]