SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6XVJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6XVJ1
Domain Number - Region: 44-96
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.000536
Family Rabenosyn-5 Rab-binding domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6XVJ1
Sequence length 108
Comment (tr|B6XVJ1|B6XVJ1_9BIFI) Uncharacterized protein {ECO:0000313|EMBL:EEB21391.1} KW=Complete proteome OX=566552 OS=Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043. GN=BIFCAT_01220 OC=Bifidobacterium.
Sequence
MADADPLIHDFACVLIAHINLVQSTGMRTGVAKQIEIFVKRMQRHCDWYHNQESVHDHLT
QQFDAIELLLTRAVEFNRMRDEETLSECQRILAQTAIQATGASWPKTG
Download sequence
Identical sequences B6XVJ1
WP_003835485.1.44880 WP_003835485.1.64986 WP_003835485.1.93505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]