SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6Y8S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6Y8S1
Domain Number - Region: 9-33
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000536
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6Y8S1
Sequence length 60
Comment (tr|B6Y8S1|B6Y8S1_9RICK) Uncharacterized protein {ECO:0000313|EMBL:EEB55534.1} KW=Complete proteome OX=569881 OS=Wolbachia endosymbiont of Culex quinquefasciatus JHB. GN=C1A_124 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MEIVAPLFLLDAAQAGHLDVVKYLVEIANAGVNYVVSTLSLPHFDYEKNCSWKNCSNVCC
Download sequence
Identical sequences B3CPZ1 B6Y8S1
570417.WPa_0536 WP_007301971.1.17329 WP_007301971.1.70878 WP_007301971.1.9798 gi|190570954|ref|YP_001975312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]