SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7FVU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7FVU4
Domain Number 1 Region: 548-619
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000072
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0047
Further Details:      
 
Weak hits

Sequence:  B7FVU4
Domain Number - Region: 602-737
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00314
Family Pseudo ankyrin repeat 0.018
Further Details:      
 
Domain Number - Region: 808-826
Classification Level Classification E-value
Superfamily RING/U-box 0.00397
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7FVU4
Sequence length 837
Comment (tr|B7FVU4|B7FVU4_PHATC) Predicted protein {ECO:0000313|EMBL:EEC49691.1} KW=Complete proteome; Reference proteome OX=556484 OS=Phaeodactylum tricornutum (strain CCAP 1055/1). GN=PHATRDRAFT_34367 OC=Bacillariophycidae; Naviculales; Phaeodactylaceae; Phaeodactylum.
Sequence
MTESTRRSSRRREKTVYSVGDLVEVTRDESIATGRLASKQTDTAKPRWLVKFDESSWPSM
ELLETELGPILDRSDDNASQKEKQVRQKSSYELGTTLGGRGSPSKRSSSPMVSGKSENGK
ASPISTNSSDSKKKVEFIALQEESDMSGSKKRPGSLSREERSKRRQAMIEQDKLNWSKPV
MSRPPKKKKAQRDEEVVRVPMLTGTLLLYRGAHRRAEFVLTDSDINPPARRVAFISFGEN
SGGVAVIVPSVLNFAHMNLQNKDEHGDWVAFRDTPASFEARSVNEKRSVLNVASKNISRR
NSGTGSWMGKPINADASWVPVASPAPGTYSPRPSSPQGSRILFREFVGNRKKERSDILTP
SQPFMCRSSATQSSSLQACKSDILSGKKLKKGRSGSSPVPRIVIPLKPDPSILRTRTRST
TGTDSGSITFSKRRDPKIGRDISFGTVHLSDSSSVSIRSEKSGLFEKVFGFPGGQALQKP
QVKHSISTRPRILLAATVYHNTATGLWITTINTNQRGVSKNPAQANKFLKAFSFPTEKEA
RESAIANAPPKMVSFQESAKCFHCRKLFAVFKRACHCRNCGVCICASCSISWPAKMLPET
YNLKNEASLKVCTSCDTLSSLFKKALLEAKYEEAIAIYETGNVNLRTPFPPANKKDEVLY
PIHAAIEGGNLKLARWLVEDRFCPLKQIRAGRSKSDKNALIQTSKGRTVLSIAMEFLRIG
ILRFLVVERGISVFEATDTRSALRTIEAALVALPCSSEGDGIREDGASIARWDQAYFDDM
SEPSSLGDDDNVTIVSRSVRTRTNTGDCCIICMDHKINCVATPCGHQCEPFGMPSLQ
Download sequence
Identical sequences B7FVU4
2850.JGI34367 XP_002178993.1.39622 jgi|Phatr2|34367|fgenesh1_pg.C_chr_5000167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]