SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7K331 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7K331
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 7.98e-36
Family Ribosomal protein S19 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7K331
Sequence length 92
Comment (sp|B7K331|RS19_CYAP8) 30S ribosomal protein S19 {ECO:0000255|HAMAP-Rule:MF_00531} KW=Complete proteome; Reference proteome OX=41431 OS=RF-1)). GN=PCC8801_0248; OC=Cyanothecaceae; Cyanothece.
Sequence
MGRSLKKGPFVSDSLLTKIEKLNEKGDKQVIKTWSRASTILPQMVGHTIAVHNGKQHVPV
YVSEQMVGHKLGEFAPTRTFRGHAKSDKKSRR
Download sequence
Identical sequences B7K331
395962.Cyan8802_0245 41431.PCC8801_0248 gi|218245136|ref|YP_002370507.1| WP_012593628.1.62203 WP_012593628.1.93053 gi|257058161|ref|YP_003136049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]