SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7P6G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7P6G4
Domain Number 1 Region: 79-127
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000759
Family Hairy Orange domain 0.0028
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7P6G4
Sequence length 199
Comment (tr|B7P6G4|B7P6G4_IXOSC) Transcription factor hes-1, putative (Fragment) {ECO:0000313|VectorBase:ISCW016537-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW016537 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MWPHVLKTGRLIFVQATKPIMEKRRRARINQCLTELKALILDALNKDPSRHSKLEKADIL
EMTVRHLQNVQRQQMTAALATDPAVMGKFRAGFAECATEVSRYVTRLESVEPHLRQRLVG
HLSTCIPGLGDVNNNNNGNSGHNGAGRAGSAPGRLQLGGLPLIPSRLPNGDLAFVLPTVS
AVGTSWGPPTPTNTSTPTS
Download sequence
Identical sequences B7P6G4
ISCW016537-PA 6945.ISCW016537-PA XP_002408712.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]