SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PCE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PCE9
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-31
Family Calnexin/calreticulin 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7PCE9
Sequence length 169
Comment (tr|B7PCE9|B7PCE9_IXOSC) Calnexin, putative {ECO:0000313|EMBL:EEC04271.1, ECO:0000313|VectorBase:ISCW001834-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW001834 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MDFDLVLPLLSPGVLCGGKEAKEPKEASKDGAEGSVEKYGGKWQVDAAVRNHRRGDLCLV
LKTKARHHTIAAKLKKPYLFEHKPFMLQYEVQFLEEQNCGGAYVKLLCDMKDNGDLGLFD
DNFPYTFMFGPDKCGRGHKLHLIFPHGNPRNKSYEEKHWEKSGDVSKLN
Download sequence
Identical sequences B7PCE9
ISCW001834-PA XP_002409759.1.51680 6945.ISCW001834-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]