SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PPB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PPB5
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-34
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 171-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000158
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7PPB5
Sequence length 262
Comment (tr|B7PPB5|B7PPB5_IXOSC) Neurexin IV, putative (Fragment) {ECO:0000313|VectorBase:ISCW005781-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW005781 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
AEPLHLDGKSYVSMDLSRRPITSTEDSLRLRFRTNQADGLLLYSRGAQRDLLALQLVHNK
LLFSADLGGEGVVTEVTCGSLLDDNIWHDVHISRFRRELVFSVDRVVVRRVLRGDSFQLD
LNNELFIGGLPNFNQEGIKVAANFSGCLENLFLNDTNVIHELRHQDDRSLVYTRFGQVLY
NCRFEQVVPITFVSSEAMLKVGGYMQRVMNCSFDFRTFNEQGLLLYNKFSVEGYVKLFLD
TGRIRVELQGKKTPVVLLRPFD
Download sequence
Identical sequences B7PPB5
ISCW005781-PA 6945.ISCW005781-PA XP_002435607.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]