SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QLD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7QLD8
Domain Number 1 Region: 58-113
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000017
Family Preprotein translocase SecE subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7QLD8
Sequence length 134
Comment (tr|B7QLD8|B7QLD8_IXOSC) Preprotein translocase, gamma subunit, putative {ECO:0000313|EMBL:EEC19660.1, ECO:0000313|VectorBase:ISCW014034-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW014034 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MVHQEYRLRYSWHQRSNSSHGEEENPFNVGVLLSTVPVDCRGCIAQDQTGAMDQVMTFID
PFKQLSKDSIRLIKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPITHHCWFLS
IMSGHIDETCILLH
Download sequence
Identical sequences B7QLD8
ISCW014034-PA 6945.ISCW014034-PA XP_002415993.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]