SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7SU81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7SU81
Domain Number - Region: 44-69
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.00497
Family T-antigen specific domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7SU81
Sequence length 104
Comment (tr|B7SU81|B7SU81_9ABAC) Uncharacterized protein {ECO:0000313|EMBL:ACH88545.1} OX=559170 OS=Helicoverpa armigera multiple nucleopolyhedrovirus. GN=HaMNV_gp023 OC=Viruses; dsDNA viruses, no RNA stage; Baculoviridae; Alphabaculovirus.
Sequence
MGFDGQVKIYFLNKEKNVIKSDSFTCWKMCPDYLQLKIVPNAEYVQVCFSNDDQSCECIY
CIKEEEQEQDDTEQEETEQEETEEEEKEEEDEEIPIKRKRLNST
Download sequence
Identical sequences B7SU81 I3XM41
B7SU81_9ABAC YP_009011088.1.71555 gi|215401255|ref|YP_002332559.1| gi|593773465|ref|YP_009011088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]