SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7U6J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7U6J0
Domain Number 1 Region: 46-266
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.14e-119
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000408
Further Details:      
 
Domain Number 2 Region: 4-45
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.65e-18
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7U6J0
Sequence length 266
Comment (tr|B7U6J0|B7U6J0_9ARCH) McrA {ECO:0000313|EMBL:ACK44088.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
IVIAMQIGMSFIAAYRMCAGEAAVADLSFAAKHAGVVQMASLLPARRARGPNEPGGIKFG
LFADIVQANRKYPNDPAKAALEVVGAGTMLFDQIWLGSYMSGGVGFTQYATAAYTDNILD
EFTYYGMDYIKDKYKVDWKNPSESDKVKPTQDVVNDMATEVTLNAMEQYEQFPTMMEDHF
GGSQRAGVIAAASGLTTAIATGNSNAGLNGWYLSMLLHKDGWSRLGFFGYDLQDQCGSAN
SLSMEPDRGLMGELRGPNYTNYAMKI
Download sequence
Identical sequences B7U6J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]