SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7YZH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7YZH3
Domain Number - Region: 436-462
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0458
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7YZH3
Sequence length 1928
Comment (tr|B7YZH3|B7YZH3_DROME) Transient receptor potential cation channel, subfamily M ortholog, isoform G {ECO:0000313|EMBL:ACL83127.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG44240 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLKQKRLAKQKPKAKPHQPRSWIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIPGI
ESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWN
LELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALL
LEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVD
NGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPP
VPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQE
LLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIAR
SEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGP
ANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYAN
ACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWT
HGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAE
KAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVIL
GLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDT
KVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAY
MFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNM
WNPCDGAAIILFVIGLAFRFRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMM
GKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI
DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMF
QRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRKAKGLEVQRDNGLKLFLEKDDLERLY
DFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR
LRKMEESSEQILSHLAVIHRFMSTHTAGADDLRGSTINIPGEMQRMRTISISDTEGGSGP
GGNGGGGGGGGAIVPLGLGAGLNLNSLQVTTRRRFNRSLTEVRPDAYIFDEGTHFEVVPL
PEEPDEVVKSREALNEQVVRKASMQSEADSDIYIPVSQRPSTCETVKRTPYVTVRQDTGA
STESKDTLTPMGNNDDDQTLVGGDNSDDATPDINFEAARHRALRQRTVSLCRRNSETYSL
TGADINRSHISLNQLASLSRRQMSLTQSEPDSDKDAPIAQGSAHPGKSVLHAKPSRNILL
KLHSEYTSITDELESVCHMIASPTVSLPSNKASLDRPKTEMSRAEAAALLEKKHLKECEE
NDYMILEGLIESRGSIDASAQGFEIGVSIDYSHRYPLRRETAVELSPSKPSVDGDLMGGG
EGGGAGGGDSSDTSGAGSCGAMVGISSGFQLKNERPWQRNSSMEQQTYPSPLVPTRATSD
FLNPPYEGRLFKKSSESLQKNSSTETDYSAHPYRFIKQSSNETNTSLTGSYNVDTPSLTA
EPSLDAGDSHSATGISISVGAVGGTATARYQPIRTASVGAADGRRLREESSSSLDLSSSG
PVTMQAAPAPPVRPMLLKKQFSVDQGKPSQTAAEAVPQTPEAAQAGQAKLISTLKPQPFA
SKLGMNVLKESSSSTDESVGSSAKSSNPALSIPQISTHLVQDEIAKLSSNIKSSTESEKD
PPFNETMC
Download sequence
Identical sequences B7YZH3
NP_001137673.1.81976 FBpp0113072 FBpp0113072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]