SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Z114 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Z114
Domain Number 1 Region: 52-133
Classification Level Classification E-value
Superfamily RING/U-box 2.69e-37
Family RING finger domain, C3HC4 0.00000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7Z114
Sequence length 136
Comment (tr|B7Z114|B7Z114_DROME) Regulator of cullins 1a, isoform C {ECO:0000313|EMBL:ACL82876.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG16982 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEVDEDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVAL
WAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQ
VCPLDNREWDFQKYGH
Download sequence
Identical sequences B7Z114
FBpp0300874 NP_001138143.2.81976 FBpp0300874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]