SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8BCP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8BCP9
Domain Number - Region: 735-781
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0275
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8BCP9
Sequence length 910
Comment (tr|B8BCP9|B8BCP9_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC84742.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_31738 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MRRPRDGVGWEGATLTGRCSDVVAGAAAGVAAPPAAPSGGAGEAAAAAAEAAPVVGGHGE
EDIGAPLRRCVGRPTLEEKFARGVGGSVEKYDEFKWMTSLATRSIQADIVGALRRGDRQQ
ASLLLSNLQQTNRALTSEDFSHILEYCATAPDPLFVTEALELMEENAVHMSQRVYRSVTR
ALSKGGYSKEAIHWLTLLVEKESSHNYLPIFNIFLSGCGSTTKQSDIEGCLEKMETYFLG
KSEITYCELLKLAVSQRNLSAVHDIWKDCTRNYNPSIILQRKFVRALTTLGDLRSAYRIM
QHMVVLAGRNTDHLRGKGRYQRSRLDIPVPALTELEDLKILLGCDLPSSFQGKVEESEKC
STDTQPELSQEENISFENLQLKGYAEFISTGDNLSDKSVLDNGRMARPLRLVPATVKKFL
LWSFNDIVHACVQLNNCQIAEQLLLEMQRIGLQPSKFTYDGFIKAVMVGKGVAYAIKVIE
AMERRGIEPYNDTLAALSVGSSRSLQLNLAEDFLARISKPQPKYIHAFNALLAGCDMMNE
PERAVRVLAEMRHLNLKPNLRTYELLFSLFGNVNVPYEEGNVLSHADVSKRISIIETDML
NNEIQHSFVCMKNLIRAFGAEGMTEEMLKYLNVAENVLWNMDPYQKSDLYCIALHALVKA
KDTHKAIKTFMTIRSYGLPANVAIYNIMIECCKLLPCVKSASAVLSLMLRDGFYPTILTF
TSLVKVVLAREDFEGALDLLDACIIEGIQPDIEIFNTVLLEAFEKGQIHVVEYIVECIHR
AKIRPDQSTLWYTFCAYVDQELYNTAIEALQVLSVRMISEEADVLKEKGVIVEDLILSEE
PDAELKIMKTFEATEHLATALLNLRWCATMGSTISWSPEDSLWARRLASSYDGNRRPHIF
TSIVPKQFVV
Download sequence
Identical sequences B8BCP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]