SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8CYT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8CYT2
Domain Number - Region: 32-91
Classification Level Classification E-value
Superfamily FlgN-like 0.00129
Family FlgN-like 0.018
Further Details:      
 
Domain Number - Region: 106-151
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0235
Family Small-conductance potassium channel 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8CYT2
Sequence length 156
Comment (tr|B8CYT2|B8CYT2_HALOH) Uncharacterized protein {ECO:0000313|EMBL:ACL70451.1} KW=Complete proteome; Reference proteome OX=373903 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562). GN=Hore_17020 OC=Halothermothrix.
Sequence
MPVRKSREDFLLKDNSYDACKVVKENFKLLEKKYNLFYDLSLKLKQIINNKDGQSVLNII
KKRQELITQIERLEKNINNYLYKYDLSESEFESDKENIKLYIEKNLKINKKLHKKLKHAK
NDILQKYFTIRKKKKIKSGYEKNQVKLHRRIIDKKY
Download sequence
Identical sequences B8CYT2
373903.Hore_17020 gi|220932538|ref|YP_002509446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]