SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8FJF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8FJF3
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily MTH1598-like 4.71e-38
Family MTH1598-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8FJF3
Sequence length 141
Comment (tr|B8FJF3|B8FJF3_DESAA) Uncharacterized protein {ECO:0000313|EMBL:ACL05622.1} KW=Complete proteome; Reference proteome OX=439235 OS=Desulfatibacillum alkenivorans (strain AK-01). GN=Dalk_3936 OC=Desulfobacteraceae; Desulfatibacillum.
Sequence
MKKKTEYTLIDHTADYGFTLCAESPEELFANAALALTDLMLGDSPVEPRLKHRIEVEGED
RTDLMVNWLREILFLFAGEGEAFSHAEVETAEESFLCATVYTEAYDPEKHEILEEIKAVT
YHQARVEQTDGGWECQVICDV
Download sequence
Identical sequences B8FJF3
439235.Dalk_3936 WP_015948671.1.12191 gi|218781772|ref|YP_002433090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]