SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8GJI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GJI6
Domain Number 1 Region: 16-181
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.31e-39
Family CbiG N-terminal domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 174-290
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 7.06e-26
Family CobE/GbiG C-terminal domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8GJI6
Sequence length 290
Comment (tr|B8GJI6|B8GJI6_METPE) Cobalamin (Vitamin B12) biosynthesis CbiG protein {ECO:0000313|EMBL:ACL17027.1} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_1720 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MTRTVVIALPRFSGEAAMIARFLDADHRDYVAGVFAEVWGVYNRIVAVMSAGIVVRQVAP
LLKDKWQDPAVVVVSPDLRYAIPLVGGHHGANDLAKKLSKAGLLPVLTTATESLGLPSVE
GIATARQCDVVNRPSTRTVNAAILERDVPVYRIDGPAIVIAGPAVSFLVASGEYVVGIGC
RRGVTPLEVQQSVEEALSAAGIAVDDVRCYATTVQKRDEAGLIDGVFAMGGDLIFLDDQT
INAESPPSRSGADRIGLVGVAEPAALALSTKREMIMEKKVYGRVTIAIAR
Download sequence
Identical sequences B8GJI6
WP_012618346.1.75456 gi|219852318|ref|YP_002466750.1| 521011.Mpal_1720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]