SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8HYN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8HYN6
Domain Number - Region: 210-264
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0942
Family EspA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8HYN6
Sequence length 295
Comment (tr|B8HYN6|B8HYN6_CYAP4) Uncharacterized protein {ECO:0000313|EMBL:ACL46690.1} KW=Complete proteome; Reference proteome OX=395961 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141). GN=Cyan7425_4380 OC=Cyanothecaceae; Cyanothece.
Sequence
MSKPIYEIVDQLPTGGITIMALRSLDFVVPGQWQNLVGFKNTIKTVTGETDEGLIQQIGD
RAVYLFNDKSQGYQRALWLYQTVDNTDAALGAAALANKVGEKISFLGFLDKLTPKPVKAQ
SLDLTIKLVVELVAFCQINGIPGDSIGDFVAALGDYSGESLMRMAALVCFDGLIPLGPDF
ILNTMNILGQTTPSELEHNSTFKGVKDLIPGGNSAGQLGFMRQSFDSVKGWMSNFVAERA
LTPEKVVNNLQNFVQVSKDNLDYLGAFLDVSTNYYTHTGIQTLARRLIERAVAEI
Download sequence
Identical sequences B8HYN6
WP_012629736.1.77409 gi|220909740|ref|YP_002485051.1| 395961.Cyan7425_4380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]