SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8J2J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8J2J5
Domain Number - Region: 67-101
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0196
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8J2J5
Sequence length 296
Comment (tr|B8J2J5|B8J2J5_DESDA) Cell shape protein MreC {ECO:0000256|PIRNR:PIRNR038471} KW=Complete proteome; Reference proteome OX=525146 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949). GN=Ddes_0163 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MTLRRIIILAGILLILFLAMYSWNQRTRALDNLAAEVGLELAGAVLKPLRAVQDSAQDMW
DRYFDLVAVREENEILRQRVDEMEARLLANGEDMAELKRLRALIQLPVDQSWRPLGARVL
SGRMGPNAVLDSVTISRGYSTGGRPGTPLVTHLGLVGRVLKASAHSAIALLLTDPGSRIA
VFSQESRAPGILAGQGTGQPLEVNFVQRATRVNEGEILITSGLDGKYPKGIPVARVLSVA
PSDYTQFMAIKAEPLVDLHHLEEVLLLEPTGVAPPPDLGAPPKEIHGPPTPGRPAP
Download sequence
Identical sequences B8J2J5
525146.Ddes_0163 gi|220903449|ref|YP_002478761.1| WP_012623815.1.13825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]