SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8MLJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8MLJ4
Domain Number - Region: 108-187
Classification Level Classification E-value
Superfamily Cytochrome P450 0.012
Family Cytochrome P450 0.012
Further Details:      
 
Domain Number - Region: 275-305
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0314
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8MLJ4
Sequence length 538
Comment (tr|B8MLJ4|B8MLJ4_TALSN) Pentatricopeptide repeat protein {ECO:0000313|EMBL:EED15527.1} KW=Complete proteome; Reference proteome OX=441959 OS=NRRL 1006) (Penicillium stipitatum). GN=TSTA_049650 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MRLLPLTVDGLWYCLCPSFRPTYLHRSFRSSNTVRKISRRCLSSASTTASTRAPLGERHK
QGNRSFSQYESSRLTRAPLREDEDLQSQSIGDLEALLEQSSSRRRIDISKTVAILKTLLQ
KHRVNPTTRHYKAYLLANVDRQHGSAENVRSLLGEMARQGITADSATLHAALEVLAVHPD
YLLRQEVIEALRARWLSLSPVGWHHVIAGLLREDQLELALDRLDQMEGKGIPLEQWLHSL
LVYKLCDADEFTEALRLIRSRSNKAKSISSAMWLYLLRAAIRNSHYETVRYVWNNAVDLG
YQDLSVPDCRDVLGFASDHGDIGFAESVFRHLSTLQKHPTSYDYEKLVQVYAQNADVKSA
FEIICQMHKSRIPIESECTRPVLQSMETKLSDPTILWSEIRGLRKRGYEIPTTLANIVIQ
HTEVLFQRGSLSASRAIDLAVYIYKDLFDICTDGANTETFNSLISLCHQTSKPGICTFFV
KEMASLDVSPDQRTLETLILSCLDCGNDSSASKYLADLQAQGWQLSDLVKDRIREIQN
Download sequence
Identical sequences B8MLJ4
XP_002485480.1.73587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]