SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8N8S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8N8S7
Domain Number 1 Region: 13-198,233-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.23e-49
Family Ankyrin repeat 0.00029
Further Details:      
 
Weak hits

Sequence:  B8N8S7
Domain Number - Region: 306-369
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00103
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8N8S7
Sequence length 494
Comment (tr|B8N8S7|B8N8S7_ASPFN) Ankyrin repeat protein {ECO:0000313|EMBL:EED53496.1} KW=Complete proteome; Reference proteome OX=332952 OS=12722 / SRRC 167). GN=AFLA_108720 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MHNVVANTTRPSLDELRMTEILQAIERGHVDTAQSLLDGVSPDIQDRTGRTLFSRAVSLN
SKEELQSRLKAEILFDLLIARGADPDLGDHTGETPVHWAAKAGDHEMVCLLLQKGALSDL
PDKWGRTPLSRAAERGHNLAVERLLVDGRADSNSRDNRGRTPLSWAAESSHLQIVETLVN
HGADVEIRDNEGQIPLWWFLNNTDRSSPTDRGTTKEPVDFQRWCSILGPKSSIEPVTKKR
RTFLAWACERGDRQLVQELLRTTWTDPNSIDRHRKTPLIYALEWKHYEIADMLMSGVEPE
RAKKDCVSLHLLIREGRSRLLKMFLERYKSNLKEEDKYSAIPLMRMALQQSDRPTVRLLL
DYKASTQGLKSSDWFGPCSTLRAAEPLVGLNKANWDGYSSIPVMEMTIQERDRIAVATLL
GKRAQILEIEDDDDDFAQYSSNIQQSIAVDIMTRKDGRQAVEWISEDTFDQKMRELTKSP
DESHLMQQKSVQDF
Download sequence
Identical sequences B8N8S7
5059.CADAFLAP00004607 XP_002376742.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]