SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8NIZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8NIZ2
Domain Number 1 Region: 705-806
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000000111
Family SnoaL-like polyketide cyclase 0.052
Further Details:      
 
Domain Number 2 Region: 554-723
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000209
Family Pseudo ankyrin repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8NIZ2
Sequence length 815
Comment (tr|B8NIZ2|B8NIZ2_ASPFN) Uncharacterized protein {ECO:0000313|EMBL:EED50198.1} KW=Complete proteome; Reference proteome OX=332952 OS=12722 / SRRC 167). GN=AFLA_070200 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MDSFKYEPLDLDGPAFRLVRLCHGDGPDIHCELFQVWLYPEQSAISYEALSYTWGSTEIV
ESVQMNGKILGVTLNLYLALQHLRLQDEDRILWVDGICIDQANHKERGHQVRHMGDIYKQ
AERVIFWLGQPTYDTNVVLDSLHQLQKESTGYACRTWELTDPRWADLWSSVQPRLKDKYP
DLRTRQRQGLEELLSRPWFRRVWILQEVANARAGLVCCGQKSVSAHIFPLAPLLIDIIPN
TQSQAVLDIMPGPSRNGTWWNMNQDLYTLLQKFSASEARLPRDRVFALLGLSSDARDTDM
LRPDYENSEKDVIHDVVYFLFDEHIYHSQRSRFNTLQDLIMNLEALNTLFLQYYMESPDL
EDLEKVLERRCFGISEANITAAAHATRIAMSTGLGDKAGRDNGVDIGTIKVWDHLKNLEH
VLQRRGYNIEVMADLLTTIIKNADCWPATVNFFLHQRCNEFKITDPVLIALLNPPKNVVE
AAMTHVQEQQYQAQATENILQSTYVSGAPFGSKFIKLLLQQRGKGIQITDEVLCAAISNT
SFGVQFIQLLLQEQGNEIVISEKVLCAAASDVYKGLDIMVVLLEQKGNEIIITEDVLRAA
ASNRTYGQDIMKVLLEQKGNEIIITEKVLCAAALNRTYGQDIMKVLLEQKGSKIIITEKV
LCRAASNNYNGVDIMEILLEQKGNEIIITEKVLCAAASNKYNGLDIMEVLLRRKVGEAFN
KYVVENYTQHNPNILDGRQAAIEALTPLYSTDGMVFEIHQTFVGGDYGLVHVKSVTPGQN
DTAVMDMYRFEELKIVEHWDVLQTMTAGINPHPFF
Download sequence
Identical sequences B8NIZ2
XP_002380579.1.25037 5059.CADAFLAP00008444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]