SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9ACI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9ACI9
Domain Number - Region: 13-90
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0405
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9ACI9
Sequence length 124
Comment (tr|B9ACI9|B9ACI9_METSM) Uncharacterized protein {ECO:0000313|EMBL:EEE41179.1} KW=Complete proteome OX=483214 OS=Methanobrevibacter smithii DSM 2375. GN=METSMIALI_00060 OC=Methanobacteriaceae; Methanobrevibacter.
Sequence
MSIEECKQIILDNFRSIKLEKDYAQLQLSLFQVEELISHYEKLIDLQEEIQSKHYQAIKH
MEDIDLIEDYDYVKWHQKRESEALSWKHELEILSEYKRQINKILQDIEDGTAAKTLKEDE
KEFN
Download sequence
Identical sequences A0A2H4U5J1 B9ACI9
WP_004034751.1.83718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]