SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9BG36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9BG36
Domain Number - Region: 26-76
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.0144
Family Variable surface antigen VlsE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9BG36
Sequence length 82
Comment (tr|B9BG36|B9BG36_9BURK) Uncharacterized protein {ECO:0000313|EMBL:EED97059.1} KW=Complete proteome OX=513051 OS=Burkholderia multivorans CGD1. GN=BURMUCGD1_3236 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MLEKGLTMGILNTVGEIAGAVAAVEAAEKLDPDAGLLTKAAAAVAGFKGAEALEGLLEKK
EDATEQAADDTQATDGSDTSQA
Download sequence
Identical sequences B9BG36 B9BZ48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]