SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9F674 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9F674
Domain Number - Region: 296-413
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00876
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9F674
Sequence length 465
Comment (tr|B9F674|B9F674_ORYSJ) Uncharacterized protein {ECO:0000313|EMBL:EEE58590.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_09919 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MPFRPTLPRRCSHDPKLSSFLSALASLTASPSSSSSSPLPPAGSVPASPTPAAYNALMSA
YSRAGRHGEVLRLFRSLPFAPTAPLFTTLISSLAASGRPLAARAAFASLLKSGVPPTASA
FTALLRSSSDALDFVDSVFRAMEALGCSPDAAVYNWVISMLCDFQLVQEALGFLDHMLEN
GPRPTARSFTAILRAYCEQGRFFDAGRLVDTMIQNGCPPDVVSYTVLIEGLCRVGEFSTV
EMILGESESQGWMPTAVTYNIYMSGLCRMGFLDEAFRQVDIMRGRGLSVTAETVHILFDC
LCRNAMFSEAVCLLEHSEELGWDVDVFCYNTLMSRLCDVDDFARVLKLLVDLLKKGIGPD
KFSFTIAIRSLCRAGKLRLAKCLIENKGIKYDVVAFNTLIHGFCIAGDLDRVQQTRTDMI
NRDVIPNNFTDAMLIDSLCKERKFGEAKRFVLDSLEPVVTSHGYG
Download sequence
Identical sequences B9F674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]