SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9G1P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9G1P4
Domain Number - Region: 9-46
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.0667
Family eIF2alpha middle domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9G1P4
Sequence length 125
Comment (tr|B9G1P4|B9G1P4_ORYSJ) Uncharacterized protein {ECO:0000313|EMBL:EEE68961.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_27858 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MEPNTPMEKFNRVHSSIRNVIERSFGLLKMKWQILYKMPCYPMYKQKMIVEAAMVLHNYI
REHGGEDPDFARFDRDPNFIPTIPERYNKYAVPRTASDESTPERSTGTMDLFRDELATAL
SISWR
Download sequence
Identical sequences B9G1P4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]