SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9GJU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9GJU8
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000445
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9GJU8
Sequence length 69
Comment (tr|B9GJU8|B9GJU8_POPTR) Uncharacterized protein {ECO:0000313|EMBL:EEE84915.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0001s33700g OC=Populus.
Sequence
MDAIDSVFDPLREFSKDSVRLVKRCHKPDRKEFTKVAFRTAIGFVVMGFVGFFVKLIFIP
INNIIVGSV
Download sequence
Identical sequences B9GJU8
POPTR_0001s33700.1|PACid:18236224 XP_002300110.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]