SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9GRT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9GRT7
Domain Number 1 Region: 584-740
Classification Level Classification E-value
Superfamily HCP-like 0.0000523
Family HCP-like 0.036
Further Details:      
 
Weak hits

Sequence:  B9GRT7
Domain Number - Region: 402-479
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00301
Family Pseudo ankyrin repeat 0.034
Further Details:      
 
Domain Number - Region: 220-396
Classification Level Classification E-value
Superfamily HCP-like 0.0706
Family HCP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9GRT7
Sequence length 776
Comment (tr|B9GRT7|B9GRT7_POPTR) Uncharacterized protein {ECO:0000313|EMBL:EEE81962.2} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0002s18390g OC=Populus.
Sequence
MGNILLVAYLTKTLSESGTRSLDPDSIPLSESLVLQILRRNSLDSSKKMEFFKWCSVRHI
YKHSVSTYSQMFSTLCRSGYLDEVPDLLNSMKNDGVVVGSETFKLLLDAFIRSGKFDSAL
DILDHMEELGSNPNPHMYDSIIVALAKKNQVGLALSIMFKLLEASDGNEENAVGVSLPGS
VACNALLVALRNGEMKVEFKTVFAKLRGKGGFELNTWGYNICIHAFGCWGDLTTSLRLFK
EMKEKSLASGSLDPDLCTYNSLIHVLCLAGKVKDAVIVYEELKVSGHEPDAFTYRILIQG
CCKSYQMEDATKIFSEMQYNGFLPDTVVYNSLLDGMFKARKVMEACQLFEKMVQDGVRAS
CWTYNILIDGLCKNGRAEAGYNLFCGLKKKGQFVDAVTYSIVVLLLCRKGHLEEALHLVE
EMEERGFVVDLITITSLLIAFHKQGRWDCTERLMKHIRDVNLLPNVLKWRADMEASLKNP
PRSREDYTPMFPSTGGLQEIMSSISSPKSRSDDGATEDEKSSSADTDQWSSSPYMDHLAN
QAKSTDLSSQLFSLARGQRVQAKGAGSFDIDMVNTFLSIFLAKGKLSLACKLFEIFTDMG
VDPVSYTYNSIMSSFVKKGYFNRAWDVFNEMGEKVCPPDIATYNLVIQGLGKMGRADLAS
SVLDKLMKQGGYLDIVMYNTLIDALGKAGRIDEANNLFEQMKISGLNPDVVTYNIMIEVH
SKTGRLKDAYKFLKMMLDAGCLPNHVTDTTLDFLAKEIEKLRYQKASIMRQKDDSP
Download sequence
Identical sequences B9GRT7
XP_002302689.2.11743 POPTR_0002s18390.1|PACid:18246492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]