SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9IML2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9IML2
Domain Number - Region: 70-102
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0575
Family Huristasin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9IML2
Sequence length 107
Comment (tr|B9IML2|B9IML2_POPTR) Uncharacterized protein {ECO:0000313|EMBL:EEF03142.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0018s12310g OC=Populus.
Sequence
MAQLMAWNGQARFEPHRTQLSKLRQRSITSKLPLGSQAHVTELSRSAMGMNECCKVVVRW
GESVKENTALKIKTNKILNPNRIDCDKHCAGGIIRHWRGCGVSSSWL
Download sequence
Identical sequences B9IML2
XP_002324577.1.11743 3694.fgenesh4_pg.C_LG_XVIII001003 POPTR_0018s12310.1|PACid:18215055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]