SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9NZG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9NZG4
Domain Number - Region: 9-39
Classification Level Classification E-value
Superfamily TM1646-like 0.0144
Family TM1646-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9NZG4
Sequence length 53
Comment (tr|B9NZG4|B9NZG4_PROMR) Uncharacterized protein {ECO:0000313|EMBL:EEE40937.1} KW=Complete proteome OX=93058 OS=Prochlorococcus marinus str. MIT 9202. GN=P9202_1713 OC=Prochlorococcus.
Sequence
MTALTNPKKALEKICDIGNELNISVTKDEVIEYLSTIDDEATKMWLIKARGGL
Download sequence
Identical sequences B9NZG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]