SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9RTM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9RTM5
Domain Number 1 Region: 213-397
Classification Level Classification E-value
Superfamily HCP-like 0.0000994
Family HCP-like 0.024
Further Details:      
 
Weak hits

Sequence:  B9RTM5
Domain Number - Region: 310-342,411-476
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000183
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9RTM5
Sequence length 549
Comment (tr|B9RTM5|B9RTM5_RICCO) Pentatricopeptide repeat-containing protein, putative {ECO:0000313|EMBL:EEF45257.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_0911500 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MPQKHQIHKLYQIFSSPKTLKSNPSLSKSLPIPLTTPHSADSPDSPESPDLPTWLHSNKK
PEFPDGDFVIPSLADWVEHHNLGDIKEVGNHLLFHAQVSDIDRVSEILKKHYPCTDSVVQ
ALNDCGVNPTNNLISQLLNRFCNDWVPALGLFTWAKHQTGYVHPPDLYDLMVDILGRRKK
FSFMWELVKEMENLEGYVSLVTMKKVMRRLARAGNFQDAVEAFRGIEKLGVRKDIEALNV
LMDALVKEGSVEHAYSAFMEFKDSIHVDFQSFNILLHGYCKARKLDDARKIMDEMDKQGF
QPNVVSYTCFIELYCKLKDFRNVEAIFSEMQEKSCKPNVITYTIFMHALGKAKQVNKALE
VYEMMKSNCCVPDASFYSSLIFVLTQSGRLKDAWDVFEDMKKQGVSPDLLTYNTMITSAC
THLEEENALKLLRRMEEDSCKPDIQTYAPLLKMCCRKKRIKVLKFLLNHMFKNNISIDLG
TYVLLVGGLCKSGKLELACSFFEEMVMKGLIPRDRTYKMLVEELEQNNLTEAKEKIQKLM
FQTEDQTAI
Download sequence
Identical sequences B9RTM5
29844.m003246 XP_002517094.1.68434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]