SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9TNC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9TNC9
Domain Number - Region: 15-116
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00549
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9TNC9
Sequence length 172
Comment (tr|B9TNC9|B9TNC9_RICCO) H repeat-associated protein ydcC, putative {ECO:0000313|EMBL:EEF22635.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_1996720 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MGTQTAIVDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQENAQYYQTVEKSR
GQIEVREYWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENRYFIFSFKPDVLT
FANCVRGHWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLYFLKVM
Download sequence
Identical sequences B9TNC9
40963.m000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]